PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008805
Common NameRCOM_1609620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 262aa    MW: 29176.5 Da    PI: 9.4071
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008805genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.51.2e-40167244178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +CqvegC++ l +ak+yhrrhkvCe+hska++v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  30174.m008805 167 RCQVEGCHVALVKAKDYHRRHKVCEMHSKASNVIVLGLEQRFCQQCSRFHVVSEFDDAKRSCRRRLAGHNERRRKSAH 244
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.06165242IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.9E-34165229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-38166247IPR004333Transcription factor, SBP-box
PfamPF031102.2E-31168241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MENGGNVYNN GHINRNKGQT SSNTILGWDM FEPNTSRFDW ASTSNATTLF TTATAVSTSA  60
TGESTSSTTN SLIFPHQSLY YQHHDHHYQQ LSLYAGEGLS HLHPDPHLMC LKLGKRHYFE  120
DTNTIPASDR DITSFSIGKR GKPYYSVVGS QVGPSSSAAA AAVPVPRCQV EGCHVALVKA  180
KDYHRRHKVC EMHSKASNVI VLGLEQRFCQ QCSRFHVVSE FDDAKRSCRR RLAGHNERRR  240
KSAHDSVSRN SCQVIPKKAQ NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-321682411184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583063.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ01JD11e-42SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT421e-42SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLB9RD490.0B9RD49_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0002s14330.17e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.14e-36squamosa promoter binding protein-like 3